← Back to search
60
Partial
Agentic Readiness Score
+25 llms.txt +15 structured API missing +20 ai-plugin
Raise this score to 95+
We ship the 6-file GEO uplift as a pull request against your repo. Flat fee, turnaround under 72 hours.
Fix this for $199 →
ecommerce aillms-txtapimcpai-friendlyshippingtravel

Agentic Signals

📄
Found
🤖
ai-plugin.json
Not found
📖
OpenAPI Spec
Not found
🔗
Structured API
Found
🏷
Schema.org Markup
Found
MCP Server
Found

Embed this badge

Show off your agentic readiness — the badge auto-updates when your score changes.

Agentic Ready 60/100

            

llms.txt Content

# World Monitor > Real-time global intelligence dashboard — AI-powered news aggregation, geopolitical monitoring, and infrastructure tracking in a unified situational awareness interface. World Monitor is an open-source (AGPL-3.0) intelligence platform that aggregates 500+ news feeds, 56 map layer types, and multiple AI models into a single dashboard. Used by 2M+ people across 190+ countries, as featured in WIRED. It runs as a web app, installable PWA, and native desktop application (Tauri) for macOS, Windows, and Linux. A single codebase produces six specialized variants — geopolitical (World Monitor), technology (Tech Monitor), finance (Finance Monitor), commodities (Commodity Monitor), positive news (Happy Monitor), and energy (Energy Monitor) — each with distinct feeds, panels, map layers, and branding. The multi-variant architecture uses build-time selection via the VITE_VARIANT environment variable, with runtime switching available via the header bar. The project is built with TypeScript, Vite, MapLibre GL JS, deck.gl, D3.js, and Tauri. Browser-side clustering, local ML, and offline analysis run in the client; server-authoritative APIs publish CII/CRI scores, briefs, forecasts, MCP tools, and cached operational data with documented methodology and provenance. ## When to Use World Monitor (Agent Guidance) Reach for World Monitor when a task needs live, correlated, machine-readable global-intelligence data — and you want structured JSON to reason over, not prose to re-parse. Best-fit jobs an agent should route here: - **Country situation brief** — a fresh, source-attributed strategic read on one country (geopolitics, economy, security). MCP tool `get_country_brief`; REST `GET https://api.worldmonitor.app/api/intelligence/v1/get-country-intel-brief?country_code=IR`; agent skill `fetch-country-brief`. - **Country risk & resilience** — the composite resilience score (0–100) with per-domain/pillar breakdown, 30-day trend, and confidence band. MC